HPA026789

ANKLE1 antibody from Sigma-Aldrich
ANKRD41, FLJ39369, LEMD6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026789
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026789, RRID:AB_10611675
Product name
Anti-ANKLE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026789
Antibody type
Polyclonal
Antigen
ankyrin repeat and LEM domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVVKSSFTYLLLDPRETQDLPARAFSLTPAERLQT
FIRAIFYVGKGTRARPYVHLWEALGHHGRSRKQPH
QACPKVRQILDIWASGCGVVSLHCFQHVVAVEAYT
REACIVEALGIQTLTNQKQGH
Storage
-20C
Provider Type Product Number
- No reagents -