Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000239-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000239-A01, RRID:AB_463706
- Product name
- ALOX12 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ALOX12.
- Antigen sequence
PPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLS
RRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEK
LEKEITARNEQLDWPYEYLKPSCIENSVTI- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Systematic analysis of rat 12/15-lipoxygenase enzymes reveals critical role for spinal eLOX3 hepoxilin synthase activity in inflammatory hyperalgesia.
Gregus AM, Dumlao DS, Wei SC, Norris PC, Catella LC, Meyerstein FG, Buczynski MW, Steinauer JJ, Fitzsimmons BL, Yaksh TL, Dennis EA
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 May;27(5):1939-49
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2013 May;27(5):1939-49
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ALOX12 polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of ALOX12 expression in HepG2 ( Cat # L019V1 ).