HPA010691

ALOX12 antibody from Sigma-Aldrich
12S-LOX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010691
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010691, RRID:AB_1844756
Product name
Anti-ALOX12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010691
Antibody type
Polyclonal
Antigen
Arachidonate 12-lipoxygenase, 12S-type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVR
QACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKP
KAVLNQFRTDLEKLEKEITARNEQLDWPYEY
Storage
-20C
Provider Type Product Number
- No reagents -