WH0001192M2

CLIC1 antibody from Sigma-Aldrich
CLCNL1, G6, NCC27, p64CLCP
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0001192M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0001192M2, RRID:AB_1840771
Product name
Monoclonal Anti-CLIC1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0001192M2
Antibody type
Monoclonal
Antigen
CLIC1 (AAH64527, a.a. 1-242) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLW
LKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYG
TEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNT
AGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVL
DNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTL
ADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL
SNAYAREEFASTCPDDEEIELAYEQVAKALK* (w
ithout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -