Antibody data

Product number
H00001192-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001192-M02, RRID:AB_518733
Product name
CLIC1 monoclonal antibody (M02), clone 3F9
Provider product page
Abnova Corporation - H00001192-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant CLIC1.
Antigen sequence
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLW
LKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYG
TEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNT
AGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVL
DNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTL
ADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL
SNAYAREEFASTCPDDEEIELAYEQVAKALK
Isotype
IgG
Antibody clone number
3F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -