Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183124 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chloride Intracellular Channel 1 (CLIC1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the C terminal of human CLIC1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Rabbit
- Host
- Rabbit
- Antigen sequence
LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVH
RYLSN AYAREEFAST- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Involvement of the intracellular ion channel CLIC1 in microglia-mediated beta-amyloid-induced neurotoxicity.
Novarino G, Fabrizi C, Tonini R, Denti MA, Malchiodi-Albedi F, Lauro GM, Sacchetti B, Paradisi S, Ferroni A, Curmi PM, Breit SN, Mazzanti M
The Journal of neuroscience : the official journal of the Society for Neuroscience 2004 Jun 9;24(23):5322-30
The Journal of neuroscience : the official journal of the Society for Neuroscience 2004 Jun 9;24(23):5322-30
No comments: Submit comment
No validations: Submit validation data