Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183126 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chloride Intracellular Channel 1 (CLIC1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CLIC1 antibody: synthetic peptide directed towards the N terminal of human CLIC1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKL
AALNP ESNTAGLDIF- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Chloride intracellular channel 1 regulates osteoblast differentiation.
Involvement of the intracellular ion channel CLIC1 in microglia-mediated beta-amyloid-induced neurotoxicity.
Yang JY, Jung JY, Cho SW, Choi HJ, Kim SW, Kim SY, Kim HJ, Jang CH, Lee MG, Han J, Shin CS
Bone 2009 Dec;45(6):1175-85
Bone 2009 Dec;45(6):1175-85
Involvement of the intracellular ion channel CLIC1 in microglia-mediated beta-amyloid-induced neurotoxicity.
Novarino G, Fabrizi C, Tonini R, Denti MA, Malchiodi-Albedi F, Lauro GM, Sacchetti B, Paradisi S, Ferroni A, Curmi PM, Breit SN, Mazzanti M
The Journal of neuroscience : the official journal of the Society for Neuroscience 2004 Jun 9;24(23):5322-30
The Journal of neuroscience : the official journal of the Society for Neuroscience 2004 Jun 9;24(23):5322-30
No comments: Submit comment
No validations: Submit validation data