HPA008917

CLIC1 antibody from Sigma-Aldrich
NCC27, p64CLCP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008917
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008917, RRID:AB_1846929
Product name
Anti-CLIC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008917
Antibody type
Polyclonal
Antigen
Chloride intracellular channel protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLW
LKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYG
Storage
-20C
Provider Type Product Number
- No reagents -