HPA013859

ALOX15 antibody from Sigma-Aldrich
15-LOX-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013859
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013859, RRID:AB_1844758
Product name
Anti-ALOX15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013859
Antibody type
Polyclonal
Antigen
Arachidonate 15-lipoxygenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGL
ILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLA
DLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERV
RDSWKEDALFGYQ
Storage
-20C
Provider Type Product Number
- No reagents -