WH0029780M1

PARVB antibody from MilliporeSigma / Merck KGaA
CGI-56
ELISA
Recommended by provider

Antibody data

Product number
WH0029780M1
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-PARVB antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0029780M1
Antibody type
Monoclonal
Antigen
PARVB (AAH46103, a.a. 1-351) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAI
NSPMSPALADVHPEDTQLEENEERTMIDPTSKEDP
KFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQ
VLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLE
AVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSL
AMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISE
ELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKS
LITFVNKHLN (without GST)
Isotype
IgG
Storage
-20C