ABIN1738565

antibody from antibodies-online

Targeting: PTGER4 EP4

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN1738565 - Provider product page
Provider: antibodies-online
Product name: anti-Prostaglandin E Receptor 4 (Subtype EP4) (PTGER4) (C-Term), (AA 459-488) antibody
Antibody type: Polyclonal
Antigen: Synthetic peptide from the human EP4 receptor C-terminal AA 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) conjugated to KLH
Description: Purified
Reactivity: Human, Mouse, Rat, Sheep
Host: Rabbit
Epitope: C-Term,AA 459-488
Isotype: IgG
Vial size: 250 μL
Concentration: 0.2 mg/mL
Storage: 4°C/-20°C
Handling: Avoid freeze-thaw cycles.

PTGER4 protein structure - ABIN1738565 shown in red.