HPA011226

PTGER4 antibody from Sigma-Aldrich
EP4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011226
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011226, RRID:AB_1855885
Product name
Anti-PTGER4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011226
Antibody type
Polyclonal
Antigen
Prostaglandin E2 receptor EP4 subtype recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLYQPSLEREVSKNPDLQAIRIASVNPILDPWIYI
LLRKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSD
SQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLS
LPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLR
ISETSDSSQG
Storage
-20C
Provider Type Product Number
- No reagents -