Antibody data

Product number
H00054108-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054108-M11, RRID:AB_1137135
Product name
CHRAC1 monoclonal antibody (M11), clone 4E7
Provider product page
Abnova Corporation - H00054108-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CHRAC1.
Antigen sequence
MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVS
SINQEALVLTAKATELFVQCLATYSYRHGSGKEKK
VLTYSDLANTAQQSETFQFLADILPK
Isotype
IgG
Antibody clone number
4E7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -