HPA015234

PREX2 antibody from Sigma-Aldrich
DEP.2, DEPDC2, FLJ12987, P-REX2, PPP1R129
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015234
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015234, RRID:AB_1847604
Product name
Anti-PREX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015234
Antibody type
Polyclonal
Antigen
Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQ
WVYNSIESAQEDLQKSHSKPPGDEAGDAFDCKVEE
VIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEY
DSTAGIKCNV
Storage
-20C
Provider Type Product Number
- No reagents -