HPA015234

antibody from Atlas Antibodies

Targeting: PREX2 DEP.2, DEPDC2, FLJ12987, P-REX2, PPP1R129

Antibody data

Submit

Validation data

Product number: HPA015234 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA015234, RRID:AB_1847604
Product name: Anti-PREX2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII KVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQ WVYNSIESAQEDLQKSHSKPPGDEAGDAFDCKVEE VIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEY DSTAGIKCNV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PREX2 protein structure - HPA015234 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and small intestine tissues using HPA015234 antibody. Corresponding PREX2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows strong membranous positivity in a subset of exocrine glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreatic cancer shows moderate membranous positivity in tumor cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colorectal cancer shows strong membranous positivity in tumor cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate to strong membranous positivity in glandular cells.
Sample type: HUMAN