HPA015234

PREX2 antibody from Atlas Antibodies
DEP.2, DEPDC2, FLJ12987, P-REX2, PPP1R129
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015234
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015234, RRID:AB_1847604
Product name
Anti-PREX2
Provider product page
Atlas Antibodies - HPA015234
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQ
WVYNSIESAQEDLQKSHSKPPGDEAGDAFDCKVEE
VIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEY
DSTAGIKCNV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -