Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010406-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010406-M01, RRID:AB_425845
- Product name
- WFDC2 monoclonal antibody (M01), clone 3F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant WFDC2.
- Antigen sequence
EKTGVCPELQADQNCTQECVSDSECADNLKCCSAG
CATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVD
SQCPGQMKCCRNGCGKVSCVTPNF- Isotype
- IgG
- Antibody clone number
- 3F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Detection of serum human epididymis secretory protein 4 in patients with ovarian cancer using a label-free biosensor based on localized surface plasmon resonance.
Yuan J, Duan R, Yang H, Luo X, Xi M
International journal of nanomedicine 2012;7:2921-8
International journal of nanomedicine 2012;7:2921-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged WFDC2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol