Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009138-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009138-M02, RRID:AB_714669
- Product name
- ARHGEF1 monoclonal antibody (M02), clone 2D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARHGEF1.
- Antigen sequence
CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGP
PRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQL
EELEEEFCRLRPLLSQLGGNSVPQPGCT- Isotype
- IgG
- Antibody clone number
- 2D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ARHGEF1 expression in transfected 293T cell line by ARHGEF1 monoclonal antibody (M02), clone 2D2.Lane 1: ARHGEF1 transfected lysate (Predicted MW: 102.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ARHGEF1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol