HPA012924

ARHGEF1 antibody from Sigma-Aldrich
LBCL2, P115-RHOGEF, SUB1.5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012924
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012924, RRID:AB_1845000
Product name
Anti-ARHGEF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012924
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPA
KTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAE
KPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPL
SLDSPDREP
Storage
-20C
Provider Type Product Number
- No reagents -