HPA012924

ARHGEF1 antibody from Atlas Antibodies
LBCL2, P115-RHOGEF, SUB1.5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012924
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012924, RRID:AB_1845000
Product name
Anti-ARHGEF1
Provider product page
Atlas Antibodies - HPA012924
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPA
KTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAE
KPGATDRKGGVGMPSRDRNIGAPGQDTPGVSLHPL
SLDSPDREP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -