H00057091-B01

CASS4 antibody from Abnova Corporation
C20orf32, HEFL, HEPL

Antibody data

Product number
H00057091-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057091-B01, RRID:AB_1204030
Product name
C20orf32 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00057091-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C20orf32 protein.
Antigen sequence
MKGTGIMDCAPKALLARALYDNCPDCSDELAFSRG
DILTILEQHVPESEGWWKCLLHGRQGLAPANRLQI
LTEVAADRPCPPFLRGLEEAPASSEETYQVPTLPR
PPTPGPVYEQMRSWAEGPQPPTAQVYEFPDPPTSA
RIICEKTLSFPKQAILTLPRPVRASLPTLPSQVYD
VPTQHRGPVVLKEPEKQQLYDIPASPKKAGLHPPD
SQASGQGVPLISVTTLRRGGYSTLPNPQKSEWIYD
TPVSPGKASVRNTPLTSFAEESRPHALPSSSSTFY
NPPSGRSRSLTPQLNNNVPMQKKLSLPEIPSYGFL
VPRGTFPLDEDVSYKVPSSFLIPRVEQQNTKPNIY
DIPKATSSVSQAGKELEKAKEVSENSAGHNSSWFS
RRTTSPSPEPDRLSGSSSDSRASIVSSCSTTSTDD
SSSSSSEESAKELSLDLDVAKETVMALQHKVVSSV
AGLMLFVSRKWRFRDYLEANIDAIHRSTDHIEESV
REFLDFARGVHGTACNLTDSNLQNRIRDQMQTISN
SYRILLETKESLDNRNWPLEVLVTDSVQNSPDDLE
RFVMVARMLPEDIKRFASIVIANGRLLFKRNCEKE
ETVQLTPNAEFKCEKYIQPPQRETESHQKSTPSTK
QREDEHSSELLKKNRANICGQVSSEFQVIEKGASI
VTWSSGY
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -