HPA012659

CASS4 antibody from Sigma-Aldrich
C20orf32, HEFL, HEPL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012659
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012659, RRID:AB_1845684
Product name
Anti-CASS4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012659
Antibody type
Polyclonal
Antigen
HEF-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDNCPDCSDELAFSRGDILTILEQHVPESEGWWKC
LLHGRQGLAPANRLQILTEVAADRPCPPFLRGLEE
APASSEETYQVPTLPRPPTPGPVYEQMRSWAEGPQ
PPTAQVYEFPDP
Storage
-20C
Provider Type Product Number
- No reagents -