Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00117156-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00117156-M01, RRID:AB_519038
- Product name
- SCGB3A2 monoclonal antibody (M01), clone 1B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant SCGB3A2.
- Antigen sequence
MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLA
PLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKC
VNELGPEASEAVKKLLEALSHLV- Isotype
- IgG
- Antibody clone number
- 1B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Development of a new sensitive ELISA for the determination of uteroglobin-related protein 1, a new potential biomarker.
Van De Velde V, Courtens W, Bernard A
Biomarkers : biochemical indicators of exposure, response, and susceptibility to chemicals 2010 Nov;15(7):619-24
Biomarkers : biochemical indicators of exposure, response, and susceptibility to chemicals 2010 Nov;15(7):619-24
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SCGB3A2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol