Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005527-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005527-M01, RRID:AB_1204826
- Product name
- PPP2R5C monoclonal antibody (M01), clone 3G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PPP2R5C.
- Antigen sequence
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPP
ADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKR
AALSEMVEYITHNRNVITEPIYPEVVHMFA- Isotype
- IgG
- Antibody clone number
- 3G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PPP2R5C expression in transfected 293T cell line by PPP2R5C monoclonal antibody (M01), clone 3G9.Lane 1: PPP2R5C transfected lysate(61.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PPP2R5C is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between TP53 and PPP2R5C. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PPP2R5C mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)