HPA027553

PPP2R5C antibody from Sigma-Aldrich
B56G, B56gamma, PR61G
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027553
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027553, RRID:AB_10602081
Product name
Anti-PPP2R5C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027553
Antibody type
Polyclonal
Antigen
protein phosphatase 2, regulatory subunit B', gamma isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCT
QQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQ
KDPKKDRPLARRKSELPQDPHTKKALEAHC
Storage
-20C
Provider Type Product Number
- No reagents -