Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008395-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008395-A01, RRID:AB_606775
- Product name
- PIP5K1B polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PIP5K1B.
- Antigen sequence
TYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMH
EGLYFDTETYNALMKTLQRDCRVLESFKIMDYSLL
LGIHFLDHSLKEKEEETPQNVPDAKRTGMQKVLYS
TAMES- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cis-silencing of PIP5K1B evidenced in Friedreich's ataxia patient cells results in cytoskeleton anomalies.
Bayot A, Reichman S, Lebon S, Csaba Z, Aubry L, Sterkers G, Husson I, Rak M, Rustin P
Human molecular genetics 2013 Jul 15;22(14):2894-904
Human molecular genetics 2013 Jul 15;22(14):2894-904
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PIP5K1B polyclonal antibody (A01), Lot # 060927JCS1 Western Blot analysis of PIP5K1B expression in Y-79 ( Cat # L042V1 ).