HPA009687

PIP5K1B antibody from Atlas Antibodies
MSS4, STM7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009687
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009687, RRID:AB_1235239
Product name
Anti-PIP5K1B
Provider product page
Atlas Antibodies - HPA009687
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YFDTETYNALMKTLQRDCRVLESFKIMDYSLLLGI
HFLDHSLKEKEEETPQNVPDAKRTGMQKVLYSTAM
ESIQGPGKSGDGIITENPDTMGGIPAKSH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -