HPA009687

PIP5K1B antibody from Sigma-Aldrich
MSS4, STM7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009687
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009687, RRID:AB_1855391
Product name
Anti-PIP5K1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009687
Antibody type
Polyclonal
Antigen
Phosphatidylinositol-4-phosphate 5-kinase type-1 beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YFDTETYNALMKTLQRDCRVLESFKIMDYSLLLGI
HFLDHSLKEKEEETPQNVPDAKRTGMQKVLYSTAM
ESIQGPGKSGDGIITENPDTMGGIPAKSH
Storage
-20C
Provider Type Product Number
- No reagents -