HPA009705

FRMD4B antibody from Atlas Antibodies
GRSP1, KIAA1013
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009705
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009705, RRID:AB_1849147
Product name
Anti-FRMD4B
Provider product page
Atlas Antibodies - HPA009705
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRGWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFA
GLQVPCSPSSRASLYSSVSSTNASGNWRTQLTIGL
SDYETPAHSSYTSCYGNVYNPLPSPSRQYTEISQL
DGTDGN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -