HPA009705

FRMD4B antibody from Sigma-Aldrich
GRSP1, KIAA1013
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009705
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009705, RRID:AB_1849147
Product name
Anti-FRMD4B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009705
Antibody type
Polyclonal
Antigen
FERM domain-containing protein 4B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRGWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFA
GLQVPCSPSSRASLYSSVSSTNASGNWRTQLTIGL
SDYETPAHSSYTSCYGNVYNPLPSPSRQYTEISQL
DGTDGN
Storage
-20C
Provider Type Product Number
- No reagents -