Antibody data

Product number
PAB20070
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20070, RRID:AB_10962885
Product name
RRP7A polyclonal antibody
Provider product page
Abnova Corporation - PAB20070
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant RRP7A.
Antigen sequence
VRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLST
CGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGF
QVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSG
IHKWISDYA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -