HPA001586

RRP7A antibody from Atlas Antibodies
CGI-96, Rrp7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001586
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001586, RRID:AB_1078506
Product name
Anti-RRP7A
Provider product page
Atlas Antibodies - HPA001586
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLST
CGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGF
QVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSG
IHKWISDYA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -