HPA001586

RRP7A antibody from Sigma-Aldrich
CGI-96
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001586
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001586, RRID:AB_1078506
Product name
Anti-ZG14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001586
Antibody type
Polyclonal
Antigen
Ribosomal RNA-processing protein 7 homolog A (Gastric cancer antigen Zg14)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLST
CGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGF
QVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSG
IHKWISDYA
Storage
-20C
Provider Type Product Number
- No reagents -