HPA010088

CD63 antibody from Sigma-Aldrich
ME491, MLA1, TSPAN30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010088
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010088, RRID:AB_1846323
Product name
Anti-CD63 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010088
Antibody type
Polyclonal
Antigen
CD63 antigen recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQAD
FKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGC
GINFNEKAIHKEGCVEKIG
Storage
-20C
Provider Type Product Number
- No reagents -