HPA034581

ADAMTS7 antibody from MilliporeSigma / Merck KGaA
ADAM-TS7, DKFZp434H204
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034581
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034581, RRID:AB_10601790
Product name
Anti-ADAMTS7 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034581
Antibody type
Polyclonal
Antigen
ADAM metallopeptidase with thrombospondin type 1 motif, 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPAPGRATEGRAALDIVHPVRVDAGGSFLSYELWP
RALRKRDVSVRRDAPAFYELQYRGRELRFNLTANQ
HLLAPGFVSETRRRGGLGRAHIRAHT
Storage
-20C
Provider Type Product Number
- No reagents -