HPA011135

MSN antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011135
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011135, RRID:AB_1854053
Product name
Anti-MSN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011135
Antibody type
Polyclonal
Antigen
Moesin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KKAQQELEEQTRRALELEQERKRAQSEAEKLAKER
QEAEEAKEALLQASRDQKKTQEQLALEMAELTARI
SQLEMARQKKESEAVEWQQKAQMVQEDLEKT
Storage
-20C
Provider Type Product Number
- No reagents -