ABIN404830

MORF4L1 antibody from antibodies-online
Eaf3, HsT17725, MEAF3, MORFRG15, MRG15

Antibody data

Product number
ABIN404830
Provider
antibodies-online
Product name
anti-Mortality Factor 4 Like 1 (MORF4L1) (N-Term) antibody
Provider product page
antibodies-online - ABIN404830
Antibody type
Polyclonal
Antigen
The immunogen for anti-MORF4L1 antibody: synthetic peptide directed towards the N terminal of human MORF4L1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
KDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNL
QKQRE LQKANQEQYA
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -