HPA011138

APPL1 antibody from Sigma-Aldrich
APPL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011138
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011138, RRID:AB_1844959
Product name
Anti-APPL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011138
Antibody type
Polyclonal
Antigen
DCC-interacting protein 13-alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRS
ESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAE
LDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEE
Q
Storage
-20C
Provider Type Product Number
- No reagents -