Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011065-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011065-M01, RRID:AB_489995
- Product name
- UBE2C monoclonal antibody (M01), clone 9D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UBE2C.
- Antigen sequence
AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYH
PNVDTQGNICLDILKEKWSALYDVRTILLSIQSLL
GEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQV
TSQEP- Isotype
- IgG
- Antibody clone number
- 9D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ubiquitin-conjugating enzyme UBE2C is highly expressed in breast microcalcification lesions.
Oligonucleotide microarray identifies genes differentially expressed during tumorigenesis of DMBA-induced pancreatic cancer in rats.
UBE2C is a marker of unfavorable prognosis in bladder cancer after radical cystectomy.
Multicenter validation of cyclin D1, MCM7, TRIM29, and UBE2C as prognostic protein markers in non-muscle-invasive bladder cancer.
A study of UbcH10 expression and its association with recurrence of meningiomas.
Association of clinicopathological features with UbcH10 expression in colorectal cancer.
Expression of ubiquitin-conjugating enzyme E2C/UbcH10 in astrocytic tumors.
Chou CP, Huang NC, Jhuang SJ, Pan HB, Peng NJ, Cheng JT, Chen CF, Chen JJ, Chang TH
PloS one 2014;9(4):e93934
PloS one 2014;9(4):e93934
Oligonucleotide microarray identifies genes differentially expressed during tumorigenesis of DMBA-induced pancreatic cancer in rats.
Guo JC, Li J, Yang YC, Zhou L, Zhang TP, Zhao YP
PloS one 2013;8(12):e82910
PloS one 2013;8(12):e82910
UBE2C is a marker of unfavorable prognosis in bladder cancer after radical cystectomy.
Morikawa T, Kawai T, Abe H, Kume H, Homma Y, Fukayama M
International journal of clinical and experimental pathology 2013;6(7):1367-74
International journal of clinical and experimental pathology 2013;6(7):1367-74
Multicenter validation of cyclin D1, MCM7, TRIM29, and UBE2C as prognostic protein markers in non-muscle-invasive bladder cancer.
Fristrup N, Birkenkamp-Demtröder K, Reinert T, Sanchez-Carbayo M, Segersten U, Malmström PU, Palou J, Alvarez-Múgica M, Pan CC, Ulhøi BP, Borre M, Ørntoft TF, Dyrskjøt L
The American journal of pathology 2013 Feb;182(2):339-49
The American journal of pathology 2013 Feb;182(2):339-49
A study of UbcH10 expression and its association with recurrence of meningiomas.
Jiang L, Wang T, Bao Y, Qian J, Wu XJ, Hu GH, Lu YC
Journal of surgical oncology 2012 Sep 1;106(3):327-31
Journal of surgical oncology 2012 Sep 1;106(3):327-31
Association of clinicopathological features with UbcH10 expression in colorectal cancer.
Chen S, Chen Y, Hu C, Jing H, Cao Y, Liu X
Journal of cancer research and clinical oncology 2010 Mar;136(3):419-26
Journal of cancer research and clinical oncology 2010 Mar;136(3):419-26
Expression of ubiquitin-conjugating enzyme E2C/UbcH10 in astrocytic tumors.
Jiang L, Huang CG, Lu YC, Luo C, Hu GH, Liu HM, Chen JX, Han HX
Brain research 2008 Mar 27;1201:161-6
Brain research 2008 Mar 27;1201:161-6
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- UBE2C monoclonal antibody (M01), clone 9D3 Western Blot analysis of UBE2C expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of UBE2C expression in transfected 293T cell line by UBE2C monoclonal antibody (M01), clone 9D3.Lane 1: UBE2C transfected lysate(19.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UBE2C is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to UBE2C on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to UBE2C on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol