Antibody data

Product number
H00011065-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011065-M12, RRID:AB_1137518
Product name
UBE2C monoclonal antibody (M12), clone 1D8
Provider product page
Abnova Corporation - H00011065-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant UBE2C.
Antigen sequence
GAARGPVGKRLQQELMTLMMSGDKGISAFPESDNL
FKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAP
TVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVR
Isotype
IgG
Antibody clone number
1D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -