Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA053834 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA053834, RRID:AB_2682276
- Product name
- Anti-PHF21B
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VTGPQVSSLQRLAGQGAAVLPQVRPKTLIPDSLPV
APGRDRPPKQPPTFQKATVVSVKNPSPALPTANNT
VSHVP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PHF21B overexpression promotes cancer stem cell-like traits in prostate cancer cells by activating the Wnt/β-catenin signaling pathway
Li Q, Ye L, Guo W, Wang M, Huang S, Peng X
Journal of Experimental & Clinical Cancer Research 2017;36(1)
Journal of Experimental & Clinical Cancer Research 2017;36(1)
No comments: Submit comment
No validations: Submit validation data