HPA011906

CD151 antibody from Sigma-Aldrich
PETA-3, RAPH, SFA-1, TSPAN24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011906
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011906, RRID:AB_1846245
Product name
Anti-CD151 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011906
Antibody type
Polyclonal
Antigen
CD151 antigen recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQE
FHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKT
VVALCGQRDHASNIYKVEGGCITKLETF
Storage
-20C
Provider Type Product Number
- No reagents -