H00001606-M02

DGKA antibody from Abnova Corporation
DAGK, DAGK1, DGK-alpha

Antibody data

Product number
H00001606-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001606-M02, RRID:AB_1237688
Product name
DGKA monoclonal antibody (M02), clone 2B7
Provider product page
Abnova Corporation - H00001606-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant DGKA.
Antigen sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFE
DGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL
SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSL
LEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL
QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSV
SQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP
KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQ
CAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG
RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAV
GHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT
SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKS
GGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPP
VAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE
MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYF
SIGVDASIAHRFYIMREKYPEKFNSRMKNKLWYFE
FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLE
GIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG
ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEM
GQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE
PWVQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS
Isotype
IgG
Antibody clone number
2B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -