HPA027282

MOK antibody from Sigma-Aldrich
RAGE, RAGE1, STK30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027282
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027282, RRID:AB_10599824
Product name
Anti-RAGE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027282
Antibody type
Polyclonal
Antigen
renal tumor antigen recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFESIEQVNNLREIQALRRLNPHPNILMLHEVVFD
RKSGSLALICELMDMNIYELIRGRRYPLSEKKIMH
YMYQLCKSLDH
Storage
-20C
Provider Type Product Number
- No reagents -