HPA017168

PIP5K1C antibody from Sigma-Aldrich
KIAA0589, LCCS3, PIP5Kgamma
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017168
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017168, RRID:AB_1855395
Product name
Anti-PIP5K1C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017168
Antibody type
Polyclonal
Antigen
Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGG
ALLAVKPLGPTAAFSASQIPSEREEAQYDLRGARS
YPTLEDEGRPDLLPCTPPSFEEATTASIATTLSST
SLSIPERS
Storage
-20C
Provider Type Product Number
- No reagents -