HPA034749

RBP7 antibody from MilliporeSigma / Merck KGaA
CRBPIV
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034749
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034749, RRID:AB_10602084
Product name
Anti-RBP7 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034749
Antibody type
Polyclonal
Antigen
retinol binding protein 7, cellular recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKF
KVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKG
EK
Storage
-20C
Provider Type Product Number
- No reagents -