Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002765-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002765-M01, RRID:AB_606307
- Product name
- GML monoclonal antibody (M01), clone 5F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GML.
- Antigen sequence
CPYHIRRCMTISIRINSRELLVYKNCTNNCTFVYA
AEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTN
LERDMLPDEVTEEELPEGTVRLGVSKLLLSFASII
VSNILP- Isotype
- IgG
- Antibody clone number
- 5F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression of LY6D is induced at the surface of MCF10A cells by X-ray irradiation.
Kurosawa M, Jeyasekharan AD, Surmann EM, Hashimoto N, Venkatraman V, Kurosawa G, Furukawa K, Venkitaraman AR, Kurosawa Y
The FEBS journal 2012 Dec;279(24):4479-91
The FEBS journal 2012 Dec;279(24):4479-91
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GML is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol