HPA001878

CHEK2 antibody from Sigma-Aldrich
bA444G7, CDS1, CHK2, HuCds1, PP1425, RAD53
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001878
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001878, RRID:AB_1078514
Product name
Anti-CHEK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001878
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase Chk2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPED
QEPEDQEPEEPTPAPWARLWALQDGFANLECVNDN
YWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIF
REVGPKNSYIAYIEDHSGNG
Storage
-20C
Provider Type Product Number
- No reagents -