Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182703 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 839 (ZNF839) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C14ORF131 antibody: synthetic peptide directed towards the middle region of human C14ORF131
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KMCQDYLSSSGLCSQETLEINNDKVAESLGITEFL
RKKEI HPDNLGPKHL- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
Scanlan MJ, Gordan JD, Williamson B, Stockert E, Bander NH, Jongeneel V, Gure AO, Jäger D, Jäger E, Knuth A, Chen YT, Old LJ
International journal of cancer. Journal international du cancer 1999 Nov 12;83(4):456-64
International journal of cancer. Journal international du cancer 1999 Nov 12;83(4):456-64
No comments: Submit comment
No validations: Submit validation data