HPA011911

DSC2 antibody from Sigma-Aldrich
CDHF2, DSC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011911
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011911, RRID:AB_1847618
Product name
Anti-DSC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011911
Antibody type
Polyclonal
Antigen
Desmocollin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IGVVNEAPFSREASPRSAMSTATVTVNVEDQDEGP
ECNPPIQTVRMKENAEVGTTSNGYKAYDPETRSSS
GIRYKKLTDPTGWVTIDENTGSIKVFRSLDREAET
IKNGIYNITVLASDQGGRTCTGTLGIILQDVNDNS
Storage
-20C
Provider Type Product Number
- No reagents -