HPA012615

antibody from Atlas Antibodies

Targeting: DSC2 CDHF2, DSC3

Antibody data

Submit

Validation data

Product number: HPA012615 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA012615, RRID:AB_1847619
Product name: Anti-DSC2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KTVIICKPTMSSAEIVAVDPDEPIHGPPFDFSLES STSEVQRMWRLKAINDTAARLSYQNDPPFGSYVVP ITVRDRLGMSSVTSLDVTLCDCITENDCTHRVDPR IGGGGVQLGKW
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

DSC2 protein structure - HPA012615 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using HPA012615 antibody. Corresponding DSC2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, esophagus, liver and tonsil using Anti-DSC2 antibody HPA012615 (A) shows similar protein distribution across tissues to independent antibody HPA011911 (B).
Antibody #2 product nr: HPA011911
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows strong membranous positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows weak membranous positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows moderate membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong membranous positivity in squamous epithelial cells.
Sample type: HUMAN