HPA012615

DSC2 antibody from Atlas Antibodies
CDHF2, DSC3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012615
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012615, RRID:AB_1234154
Product name
Anti-DSC2
Provider product page
Atlas Antibodies - HPA012615
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KTVIICKPTMSSAEIVAVDPDEPIHGPPFDFSLES
STSEVQRMWRLKAINDTAARLSYQNDPPFGSYVVP
ITVRDRLGMSSVTSLDVTLCDCITENDCTHRVDPR
IGGGGVQLGKW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -